PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family TALE
Protein Properties Length: 354aa    MW: 39732.5 Da    PI: 6.5088
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.88.9e-092813152155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+ +q+ +WF N+R ++
  XP_015881151.1 281 KWPYPSEAQKLALAESTGLDLKQINNWFINQRKRH 315
                     569*****************************885 PP

2ELK40.65.3e-14235256122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKY+gyLgsLkqEF+
  XP_015881151.1 235 ELKVQLLRKYGGYLGSLKQEFL 256
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012559.2E-1885129IPR005540KNOX1
PfamPF037903.1E-2187125IPR005540KNOX1
SMARTSM012561.0E-25145196IPR005541KNOX2
PfamPF037912.0E-22148194IPR005541KNOX2
SMARTSM011884.1E-7235256IPR005539ELK domain
PfamPF037899.7E-10235256IPR005539ELK domain
PROSITE profilePS5121311.278235255IPR005539ELK domain
PROSITE profilePS5007111.872255318IPR001356Homeobox domain
SuperFamilySSF466892.57E-19257333IPR009057Homeodomain-like
SMARTSM003893.7E-11257322IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27260319IPR009057Homeodomain-like
CDDcd000863.85E-12267319No hitNo description
PfamPF059206.2E-17275314IPR008422Homeobox KN domain
PROSITE patternPS000270293316IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEGGGNNMMM GFGENSSSGF SGAEINRRFH HHHHLHLPLS NNNNNNNSSN NNSISNNQQN  60
TCSGAGGSQR VSSAMNINIP QESNTCMKAK IMAHPLFPRL LEAYINCQKV GAPPEVVARL  120
EQACSSVTTT NSSSSEAMDV SRTSTTVSIG EDPALDQFME AYCEMLTKYE QELTKPFKEA  180
MLFLARIESQ LKALAVSSSD SAAYGTDLAG QNGSSEEDTD VVNDNFIDPQ TEDRELKVQL  240
LRKYGGYLGS LKQEFLKKKK NGKLPKEARQ QLLDWWSRHY KWPYPSEAQK LALAESTGLD  300
LKQINNWFIN QRKRHWKPSE DLQFVVMDAA HHPHYYMDTM MYNPFPMDCS SSLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2817745e-85GQ281774.1 Prunus persica class I KNOX homeobox transcription factor STM-like 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881151.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-129HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLW9QQI91e-145W9QQI9_9R
STRINGVIT_12s0059g01190.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-114KNOX/ELK homeobox transcription factor